PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB06G31100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 425aa    MW: 45043.5 Da    PI: 9.1313
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB06G31100.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.23.7e-41167243177
                   --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
           SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                   +Cq+egC+adls ak+yhrrhkvCe h+ka+vv++ g++qrfCqqCsrfh l+efDe+krsCr+rLa+hn+rrrk++
  OB06G31100.1 167 RCQAEGCKADLSGAKHYHRRHKVCEYHAKASVVAAGGKQQRFCQQCSRFHVLTEFDEAKRSCRKRLAEHNRRRRKPA 243
                   6**************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.8E-35160229IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.496165242IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.67E-39166245IPR004333Transcription factor, SBP-box
PfamPF031103.9E-31168241IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009556Biological Processmicrosporogenesis
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MMSGRMNASG EEAFPFGAMQ PGGPYVGFEH GAAAVAAAAQ RAGMQQHHHH HMYDSLDFAA  60
AMQFQEPQLL ALPPSMPMPP PPMPMPLQMP VPMPGDVYPA LGIVKREGGG VGAQDGSAAA  120
GRIGLNLGRR TYFSPGDMLA VDRLLMRSRL GGVFGLGFGG AHHQPPRCQA EGCKADLSGA  180
KHYHRRHKVC EYHAKASVVA AGGKQQRFCQ QCSRFHVLTE FDEAKRSCRK RLAEHNRRRR  240
KPATTAAAAS GKDAAASPVA AGKKPSGATT SSYTGDSKNV VAMSAAKSPI SSNTSVISCL  300
AEQQAGKQAA RPTALTLGAA PPPHDREVQQ LGAVLHAQHH HHHHHHHHQQ QEHIQVSSLV  360
HIAGNNNNNH QNGGGGGSNI LSCSSVCSSA LPSTATNGEV SDQNNDNSHN NGGNNNMHLF  420
EVDFM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-291682411184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224241KRSCRKRLAEHNRRRRKP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00090SELEXTransfer from AT1G02065Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0057601e-172AP005760.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, BAC clone:B1047G05.
GenBankAP0149621e-172AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006656320.20.0PREDICTED: squamosa promoter-binding-like protein 10
SwissprotA2YFT91e-152SPL10_ORYSI; Squamosa promoter-binding-like protein 10
SwissprotQ0DAE81e-152SPL10_ORYSJ; Squamosa promoter-binding-like protein 10
TrEMBLJ3MGG60.0J3MGG6_ORYBR; Uncharacterized protein
STRINGOB06G31100.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23753593
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.13e-45squamosa promoter binding protein-like 8